PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_3355_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family EIL
Protein Properties Length: 612aa    MW: 69101.8 Da    PI: 5.4436
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_3355_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3525.52.2e-160414201353
                    XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
           EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWk 96 
                    +el++rmw+d+mll+rlke++k+    +e  ++++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+LraWWk
  Neem_3355_f_3  41 DELERRMWRDRMLLRRLKEQNKS----REG-VDSSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLRAWWK 131
                    79*******************98....677.999************************************************************** PP

                    XXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--. CS
           EIN3  97 ekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgt 192
                    ekv+fdrngpaai+kyqa+++i++++++  t   s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl+kdqg+
  Neem_3355_f_3 132 EKVRFDRNGPAAIAKYQADHAIPGKNEDFGT-VVSTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPSGKEEWWPQLGLPKDQGP 226
                    ****************************988.9*************************************************************** PP

                    -----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XXXXXXXXXXXXXXXXXXXXXXX CS
           EIN3 193 ppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ssslrkqspkvtlsceqkedveg 286
                    ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee++ ++++++  ++ +  +s ++++s+ +++dveg
  Neem_3355_f_3 227 PPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALSRKLYPDscPPASAGGSGSFIISDTSDYDVEG 322
                    ***********************************************************************65556677****************6 PP

                    XXXXX.XXXXXXXXXX................................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXX CS
           EIN3 287 kkeskikhvqavktta................................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsis 350
                     ++++  +v++ k ++                                ++++++krk+ ++e+ +++++++ +tc+  q+++++ +l+f d++s++
  Neem_3355_f_3 323 VDNERNVEVEEYKPRDvnlfglgavgsrdrqmmtpslvpqikgevvetNADFIQKRKQLNDEPHMMMDQKI-YTCEFPQCPYNDFRLGFLDRTSRN 417
                    66666577999999889**************************************************9986.************************ PP

                    XXX CS
           EIN3 351 qne 353
                    +++
  Neem_3355_f_3 418 NHQ 420
                    *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.6E-13141288No hitNo description
Gene3DG3DSA:1.10.3180.103.0E-76163298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.05E-61167291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MGFCGNVEFF SAPPGEGEAV LGHETETAVE EDCSDDEVDV DELERRMWRD RMLLRRLKEQ  60
NKSREGVDSS KQRQSQEQAR RKKMSRAQDG ILKYMLKMME VCKAQGFVYG IIPEKGKPVT  120
GASDNLRAWW KEKVRFDRNG PAAIAKYQAD HAIPGKNEDF GTVVSTPHTL QELQDTTLGS  180
LLSALMQHCD PPQRRFPLEK GVAPPWWPSG KEEWWPQLGL PKDQGPPPYK KPHDLKKAWK  240
VGVLTAVIKH MSPDIAKIRK LVRQSKCLQD KMTAKESATW LAIINQEEAL SRKLYPDSCP  300
PASAGGSGSF IISDTSDYDV EGVDNERNVE VEEYKPRDVN LFGLGAVGSR DRQMMTPSLV  360
PQIKGEVVET NADFIQKRKQ LNDEPHMMMD QKIYTCEFPQ CPYNDFRLGF LDRTSRNNHQ  420
LNCPYHNNSP QGFGMADFQI NNDQPGVFSL PFAQPTQSKP ATPAKNQTQP QFNVSGLGLP  480
DDGQKMISDL MSFYDTNLQP NKSMNPGGLN VMEEQNHQQE QQKFQLQLDD SFYNQGVMGG  540
GNMHGQSNMS MNNSVFSSAE IRFDQCKAFD SPFDTNPGDN IADFRFNSPI NMASVDYAMD  600
PIPKQDVSMW YL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A1e-851652981134Protein ETHYLENE INSENSITIVE 3
4zds_B1e-851652981134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432540.10.0hypothetical protein CICLE_v10000617mg
RefseqXP_006432541.10.0hypothetical protein CICLE_v10000617mg
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLV4T3340.0V4T334_9R
STRINGVIT_13s0047g00250.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.10.0ETHYLENE-INSENSITIVE3-like 1